Product Added to your Cart
x

-------- OR --------

Free worldwide shipping on all items - Secure checkout

14 day returns

GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXCGXOFXPFYERZARZMWZWGZWL
English
Romania Romania Slovenia Slovenia Germany Germany Portugal Portugal Hungary Hungary Finland Finland Japan Japan France France Italy Italy Czech Republic Czech Republic Dutch Dutch Thailand Thailand Sweden Sweden Poland Poland Arabic Arabic Spain Spain Denmark Denmark Norway Norway Russia Russia Vietnamese Vietnamese Hebrew Hebrew
£0.00
Audio Equipment
Leenoz DJ Headphones
Leenoz DJ Headphones
£33.00
Reloop RHP 10 Mono Neon
Reloop RHP 10 Mono Neon
£75.00
Tascam 202 MKVII
Tascam 202 MKVII
£475.00
Omnitronic TRM-222
Omnitronic TRM-222
£500.00
Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i
Withdraw from contract